SAR1B (NM_016103) Human Recombinant Protein
CAT#: TP310593
Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2, 20 µg
View other "SAR1B" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210593 protein sequence
Red=Cloning site Green=Tags(s) MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057187 |
Locus ID | 51128 |
UniProt ID | Q9Y6B6 |
Refseq Size | 6532 |
Cytogenetics | 5q31.1 |
Refseq ORF | 594 |
Synonyms | ANDD; CMRD; GTBPB; SARA2 |
Summary | The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402500 | SAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422370 | SAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402500 | Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2 |
CNY 3080.00 |
|
LY422370 | Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1 |
CNY 3080.00 |
|
PH310593 | SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_057187) |
CNY 19520.00 |
|
PH313692 | SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_001028675) |
CNY 19520.00 |
|
TP313692 | Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1, 20 µg |
CNY 2900.00 |