Ephrin A1 (EFNA1) (NM_004428) Human Recombinant Protein
CAT#: TP310635
Recombinant protein of human ephrin-A1 (EFNA1), transcript variant 1, 20 µg
View other "Ephrin A1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210635 protein sequence
Red=Cloning site Green=Tags(s) MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILY LVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRC LRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004419 |
Locus ID | 1942 |
UniProt ID | P20827 |
Refseq Size | 1590 |
Cytogenetics | 1q22 |
Refseq ORF | 615 |
Synonyms | B61; ECKLG; EFL1; EPLG1; GMAN; LERK-1; LERK1; TNFAIP4 |
Summary | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401408 | EFNA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405448 | EFNA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401408 | Transient overexpression lysate of ephrin-A1 (EFNA1), transcript variant 1 |
CNY 3080.00 |
|
LY405448 | Transient overexpression lysate of ephrin-A1 (EFNA1), transcript variant 2 |
CNY 3080.00 |
|
PH310635 | EFNA1 MS Standard C13 and N15-labeled recombinant protein (NP_004419) |
CNY 19520.00 |
|
TP720763 | Purified recombinant protein of Human ephrin-A1 (EFNA1), transcript variant 1 |
CNY 1800.00 |
|
TP760225 | Recombinant protein of human ephrin-A1 (EFNA1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它Ephrin A1产品