TDP43 (TARDBP) (NM_007375) Human Recombinant Protein
CAT#: TP310639
Recombinant protein of human TAR DNA binding protein (TARDBP), 20 µg
View other "TDP43" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 4 publications. |
CNY 600.00
CNY 1,999.00
CNY 3,600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210639 protein sequence
Red=Cloning site Green=Tags(s) MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP GGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPS GNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.6 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro binding assay (PMID: 25738460) |
Reference Data | |
RefSeq | NP_031401 |
Locus ID | 23435 |
UniProt ID | Q13148, Q9H256, A0A024R4E2 |
Refseq Size | 4236 |
Cytogenetics | 1p36.22 |
Refseq ORF | 1242 |
Synonyms | ALS10; TDP-43 |
Summary | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
TDP-43 stabilizes G3BP1 mRNA: relevance to amyotrophic lateral sclerosis/frontotemporal dementia
,Sidibé, H;Khalfallah, Y;Xiao, S;Gómez, NB;Fakim, H;Tank, EMH;Tomasso, GD;Bareke, E;Aulas, A;McKeever, PM;Melamed, Z;Destroimaisons, L;Deshaies, JE;Zinman, L;Parker, JA;Legault, P;Tétreault, M;Barmada, SJ;Robertson, J;Velde, CV;,
Brain : a journal of neurology
,PubMed ID 34115105
[TARDBP]
|
A Liver-Enriched Long Non-Coding RNA, lncLSTR, Regulates Systemic Lipid Metabolism in Mice
,Li, P;Ruan, X;Yang, L;Kiesewetter, K;Zhao, Y;Luo, H;Chen, Y;Gucek, M;Zhu, J;Cao, H;,
Cell Metab.
,PubMed ID 25738460
[TARDBP]
|
Full-length TDP-43 forms toxic amyloid oligomers that are present in frontotemporal lobar dementia-TDP patients
,Fang, YS;Tsai, KJ;Chang, YJ;Kao, P;Woods, R;Kuo, PH;Wu, CC;Liao, JY;Chou, SC;Lin, V;Jin, LW;Yuan, HS;Cheng, IH;Tu, PH;Chen, YR;,
Nat Commun
,PubMed ID 25215604
[TARDBP]
|
Dual vulnerability of TDP-43 to calpain and caspase-3 proteolysis after neurotoxic conditions and traumatic brain injury
,Yang, Z;Lin, F;Robertson, CS;Wang, KK;,
J. Cereb. Blood Flow Metab.
,PubMed ID 24917042
[TARDBP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402137 | TARDBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402137 | Transient overexpression lysate of TAR DNA binding protein (TARDBP) |
CNY 3,080.00 |
|
PH310639 | TARDBP MS Standard C13 and N15-labeled recombinant protein (NP_031401) |
CNY 19,520.00 |
|
TP710010 | Recombinant protein of human TAR DNA binding protein (TARDBP), full length, with C-terminal DDK tag,expressed in sf9 cells |
CNY 4,020.00 |