ROMO1 (NM_080748) Human Recombinant Protein
CAT#: TP310655
Recombinant protein of human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, 20 µg
View other "ROMO1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC210655 protein sequence 
Red=Cloning site Green=Tags(s) MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF MAIGMGIRC myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 8 kDa | 
| Concentration | >0.1 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_542786 | 
| Locus ID | 140823 | 
| UniProt ID | P60602 | 
| Refseq Size | 477 | 
| Cytogenetics | 20q11.22 | 
| Refseq ORF | 237 | 
| Synonyms | bA353C18.2; C20orf52; MTGM; MTGMP | 
| Summary | The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014] | 
| Protein Families | Transmembrane | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Overexpression of Romo1 is an unfavorable prognostic biomarker and a predictor of lymphatic metastasis in non-small cell lung cancer patients
                                                ,null,
                                                OncoTargets and therapy
                                                ,PubMed ID 30087567
                                                [ROMO1]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC409065 | ROMO1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY409065 | Transient overexpression lysate of reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein | 
                                                     CNY 3080.00  | 
                                            |
| PH310655 | ROMO1 MS Standard C13 and N15-labeled recombinant protein (NP_542786) | 
                                                     CNY 19520.00  | 
                                            
