Nucleoside phosphorylase (PNP) (NM_000270) Human Recombinant Protein
CAT#: TP310759
Recombinant protein of human nucleoside phosphorylase (NP), 20 µg
View other "Nucleoside phosphorylase" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210759 protein sequence
Red=Cloning site Green=Tags(s) MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVF GFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPG FSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQ KLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA SIPLPDKAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | WB standard (PMID: 28251649) |
Reference Data | |
RefSeq | NP_000261 |
Locus ID | 4860 |
UniProt ID | P00491 |
Refseq Size | 2438 |
Cytogenetics | 14q11.2 |
Refseq ORF | 867 |
Synonyms | NP; PRO1837; PUNP |
Summary | This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Evidence for purine nucleoside phosphorylase (PNP) release from RAT C6 glioma cells
,Giuliani, P;Zuccarini, M;Buccella, S;Peña-Altamira, LE;Polazzi, E;Virgili, M;Monti, B;Poli, A;Rathbone, MP;Di Iorio, P;Ciccarelli, R;Caciagli, F;,
J. Neurochem
,PubMed ID 28251649
[PNP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424829 | PNP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424829 | Transient overexpression lysate of purine nucleoside phosphorylase (PNP) |
CNY 3080.00 |
|
PH310759 | PNP MS Standard C13 and N15-labeled recombinant protein (NP_000261) |
CNY 19520.00 |
其它Nucleoside phosphorylase产品