ENT2 (SLC29A2) (NM_001532) Human Recombinant Protein
CAT#: TP310776
Recombinant protein of human solute carrier family 29 (nucleoside transporters), member 2 (SLC29A2), 20 µg
View other "ENT2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210776 protein sequence
Red=Cloning site Green=Tags(s) MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNW VTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMSPGPFFSITMASVCFINSF SAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFITPCVGILMSIVCY LSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGK PSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSY FLWPDEDSRLLPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001523 |
| Locus ID | 3177 |
| UniProt ID | Q14542 |
| Refseq Size | 2529 |
| Cytogenetics | 11q13.2 |
| Refseq ORF | 1368 |
| Synonyms | DER12; ENT2; HNP36 |
| Summary | The uptake of nucleosides by transporters, such as SLC29A2, is essential for nucleotide synthesis by salvage pathways in cells that lack de novo biosynthetic pathways. Nucleoside transport also plays a key role in the regulation of many physiologic processes through its effect on adenosine concentration at the cell surface (Griffiths et al., 1997 [PubMed 9396714]).[supplied by OMIM, Nov 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400588 | SLC29A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400588 | Transient overexpression lysate of solute carrier family 29 (nucleoside transporters), member 2 (SLC29A2) |
CNY 3080.00 |
|
| PH310776 | SLC29A2 MS Standard C13 and N15-labeled recombinant protein (NP_001523) |
CNY 19520.00 |
