KIAA0495 (NM_207306) Human Recombinant Protein
CAT#: TP310801
Recombinant protein of human KIAA0495 (KIAA0495), 20 µg
View other "KIAA0495" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210801 protein sequence
Red=Cloning site Green=Tags(s) MCLLSSSAASDLAATSLTAHPCHPPLPRQPQPQLILSGSPSIGTVPPPAVGHTSLLPVNPPAISTTTSDL SAREDATPSASTGHLSVFPAFQVKIPAVPSEQTSQSFSEASHRVLPGGGPRCSRDFGAGVAGHLGLGIFG VGFGSPALLQSVVDENSCCLLYVVEDQLCDVEQAFRAEHLGQHQSGSGTGCRHCPQRPAAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_997189 |
| Locus ID | 57212 |
| Refseq Size | 6358 |
| Cytogenetics | 1p36.32 |
| Refseq ORF | 603 |
| Synonyms | MGC138189 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404085 | KIAA0495 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404085 | Transient overexpression lysate of KIAA0495 (KIAA0495) |
CNY 3080.00 |
|
| PH310801 | KIAA0495 MS Standard C13 and N15-labeled recombinant protein (NP_997189) |
CNY 19520.00 |
|
| TP701244 | Purified recombinant protein of Human KIAA0495 (KIAA0495), with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20ug |
CNY 2900.00 |
|
| TP701245 | Purified recombinant protein of Human KIAA0495 (KIAA0495), with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20ug |
CNY 2900.00 |
其它KIAA0495产品
