Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Recombinant Protein
CAT#: TP310897
Recombinant protein of human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8, 20 µg
View other "Macrophage Inflammatory Protein 3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210897 protein sequence
Red=Cloning site Green=Tags(s) MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_665905 |
| Locus ID | 6368 |
| UniProt ID | P55773 |
| Refseq Size | 604 |
| Cytogenetics | 17q12 |
| Refseq ORF | 360 |
| Synonyms | CK-BETA-8; Ckb-8; Ckb-8-1; CKb8; hmrp-2a; MIP-3; MIP3; MPIF-1; SCYA23 |
| Summary | This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist of the chemokine (C-C motif) receptor 1. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407835 | CCL23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407835 | Transient overexpression lysate of chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8 |
CNY 3080.00 |
|
| PH310897 | CCL23 MS Standard C13 and N15-labeled recombinant protein (NP_665905) |
CNY 19520.00 |
|
| TP720600 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8 |
CNY 1800.00 |
|
| TP723836 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23 / MPIF-1), transcript variant CKbeta8 |
CNY 4090.00 |
其它Macrophage Inflammatory Protein 3产品


