ERP29 (NM_006817) Human Recombinant Protein
CAT#: TP310918
Recombinant protein of human endoplasmic reticulum protein 29 (ERP29), transcript variant 1, 20 µg
View other "ERP29" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210918 protein sequence
Red=Cloning site Green=Tags(s) MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006808 |
| Locus ID | 10961 |
| UniProt ID | P30040 |
| Refseq Size | 1472 |
| Cytogenetics | 12q24.13 |
| Refseq ORF | 783 |
| Synonyms | C12orf8; ERp28; ERp31; HEL-S-107; PDI-DB; PDIA9 |
| Summary | This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402039 | ERP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402039 | Transient overexpression lysate of endoplasmic reticulum protein 29 (ERP29), transcript variant 1 |
CNY 3080.00 |
|
| PH310918 | ERP29 MS Standard C13 and N15-labeled recombinant protein (NP_006808) |
CNY 19520.00 |
