PCPTP1 (PTPRR) (NM_130846) Human Recombinant Protein
CAT#: TP311122
Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2, 20 µg
View other "PCPTP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211122 protein sequence
Red=Cloning site Green=Tags(s) MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIRA TTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRD VVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGY SGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNEC DNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRT GCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570897 |
Locus ID | 5801 |
UniProt ID | Q15256 |
Refseq Size | 2782 |
Cytogenetics | 12q15 |
Refseq ORF | 1236 |
Synonyms | EC-PTP; PCPTP1; PTP-SL; PTPBR7; PTPRQ |
Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domain, and thus represents a receptor-type PTP. Silencing of this gene has been associated with colorectal cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares a symbol (PTPRQ) with another gene, protein tyrosine phosphatase, receptor type, Q (GeneID 374462), which is also located on chromosome 12. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408898 | PTPRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419077 | PTPRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY408898 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2 |
CNY 3080.00 |
|
LY419077 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1 |
CNY 4840.00 |
|
PH311122 | PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_570897) |
CNY 19520.00 |
|
PH312896 | PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_002840) |
CNY 19520.00 |
|
TP312896 | Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1, 20 µg |
CNY 2900.00 |