DDR2 (NM_006182) Human Recombinant Protein
CAT#: TP311389
Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2, 20 µg
View other "DDR2" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211389 representing NM_006182
Red=Cloning site Green=Tags(s) MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP SFQEIHLLLLQQGDE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 94.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006173 |
Locus ID | 4921 |
UniProt ID | Q16832 |
Refseq Size | 3172 |
Cytogenetics | 1q23.3 |
Refseq ORF | 2565 |
Synonyms | MIG20a; NTRKR3; TKT; TYRO10; WRCN |
Summary | This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416820 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423080 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425366 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY416820 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2 |
CNY 3080.00 |
|
LY423080 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 |
CNY 3080.00 |
|
LY425366 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 |
CNY 4840.00 |
|
PH308745 | DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_001014796) |
CNY 19520.00 |
|
PH311389 | DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_006173) |
CNY 19520.00 |
|
TP308745 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP700162 | Purified recombinant protein of human discoidin domain receptor tyrosine kinase 2(DDR2), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
TP710142 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, residues 22-399aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |