CPLX4 (NM_181654) Human Recombinant Protein
CAT#: TP311569
Recombinant protein of human complexin 4 (CPLX4), 20 µg
View other "CPLX4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211569 protein sequence
Red=Cloning site Green=Tags(s) MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAER ACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKE KAQATFTEIKQTAEQKCSVM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_857637 |
| Locus ID | 339302 |
| UniProt ID | Q7Z7G2 |
| Refseq Size | 1980 |
| Cytogenetics | 18q21.32 |
| Refseq ORF | 480 |
| Synonyms | CPX-IV; CPXIV |
| Summary | This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis. [provided by RefSeq, Jan 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
