SIN1 (MAPKAP1) (NM_001006617) Human Recombinant Protein
CAT#: TP311745
Purified recombinant protein of Human mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg
View other "SIN1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211745 representing NM_001006617
Red=Cloning site Green=Tags(s) MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001006618 |
Locus ID | 79109 |
UniProt ID | Q9BPZ7 |
Refseq Size | 3395 |
Cytogenetics | 9q33.3 |
Refseq ORF | 1566 |
Synonyms | JC310; MIP1; SIN1; SIN1b; SIN1g |
Summary | This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
A p53-Phosphoinositide Signalosome Regulates Nuclear Akt Activation
,null,
Nature cell biology
,PubMed ID 35798843
[MAPKAP1]
|
The Functional Proximal Proteome of Oncogenic Ras Includes mTORC2
,Kovalski, JR;Bhaduri, A;Zehnder, AM;Neela, PH;Che, Y;Wozniak, GG;Khavari, PA;,
Mol. Cell
,PubMed ID 30639242
[MAPKAP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400381 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411350 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423519 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423693 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400381 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 6 |
CNY 3080.00 |
|
LY411350 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 2 |
CNY 3080.00 |
|
LY423519 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 5 |
CNY 3080.00 |
|
LY423693 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1 |
CNY 4840.00 |
|
PH311745 | MAPKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001006618) |
CNY 19520.00 |