MARCH8 (NM_001002265) Human Recombinant Protein
CAT#: TP311771
Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6, 20 µg
View other "MARCH8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211771 representing NM_001002265
Red=Cloning site Green=Tags(s) MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTE PEDTGAEIIHV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001002265 |
| Locus ID | 220972 |
| UniProt ID | Q5T0T0 |
| Refseq Size | 2604 |
| Cytogenetics | 10q11.21-q11.22 |
| Refseq ORF | 873 |
| Synonyms | c-MIR; MARCH-VIII; MIR; RNF178 |
| Summary | MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408083 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424197 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424198 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408083 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8 |
CNY 3080.00 |
|
| LY424197 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6 |
CNY 3080.00 |
|
| LY424198 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7 |
CNY 3080.00 |
|
| PH305477 | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002266) |
CNY 19520.00 |
|
| PH309891 | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_659458) |
CNY 19520.00 |
|
| PH311771 | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002265) |
CNY 19520.00 |
|
| TP305477 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7, 20 µg |
CNY 2900.00 |
|
| TP309891 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8, 20 µg |
CNY 2900.00 |
