RABL2A (NM_007082) Human Recombinant Protein
CAT#: TP311854
Recombinant protein of human RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 2, 20 µg
View other "RABL2A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211854 protein sequence
Red=Cloning site Green=Tags(s) MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTI LVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADIN VTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPD QEQSSSIETPSEEAASPHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009013 |
Locus ID | 11159 |
UniProt ID | Q9UBK7 |
Refseq Size | 1143 |
Cytogenetics | 2q14.1 |
Refseq ORF | 687 |
Summary | This gene is a member of the RAB gene family which belongs to the RAS GTPase superfamily. The proteins in the family of RAS-related signaling molecules are small GTP-binding proteins that play important roles in the regulation of exocytotic and endocytotic pathways. This gene maps to the site of an ancestral telomere fusion event and may be a subtelomeric gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415601 | RABL2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416219 | RABL2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415601 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 1 |
CNY 3080.00 |
|
LY416219 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 2 |
CNY 3080.00 |
|
PH311854 | RABL2A MS Standard C13 and N15-labeled recombinant protein (NP_009013) |
CNY 19520.00 |