CAB39L (NM_001079670) Human Recombinant Protein
CAT#: TP311881
Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2, 20 µg
View other "CAB39L" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211881 protein sequence
Red=Cloning site Green=Tags(s) MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001073138 |
| Locus ID | 81617 |
| UniProt ID | Q9H9S4 |
| Refseq Size | 3580 |
| Cytogenetics | 13q14.2 |
| Refseq ORF | 1011 |
| Synonyms | bA103J18.3; MO2L; MO25-BETA |
| Summary | Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | mTOR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410660 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421532 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410660 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 |
CNY 3080.00 |
|
| LY421532 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 |
CNY 3080.00 |
|
| PH303394 | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) |
CNY 19520.00 |
|
| PH311881 | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138) |
CNY 19520.00 |
|
| TP303394 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1, 20 µg |
CNY 2900.00 |
