TMSL3 (NM_183049) Human Recombinant Protein
CAT#: TP311946
Recombinant protein of human thymosin-like 3 (TMSL3), 20 µg
View other "TMSL3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211946 protein sequence
Red=Cloning site Green=Tags(s) MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 4.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_898870 |
Locus ID | 7117 |
Refseq Size | 634 |
Cytogenetics | 4q22.1 |
Refseq ORF | 132 |
Synonyms | OTTHUMP00000161564; thymosin-like 3 |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |