DEFB125 (NM_153325) Human Recombinant Protein
CAT#: TP312030
Recombinant protein of human defensin, beta 125 (DEFB125), 20 µg
View other "DEFB125" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212030 protein sequence
Red=Cloning site Green=Tags(s) MNILMLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAF PVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETA TSETMPPPSQTALTHN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_697020 |
| Locus ID | 245938 |
| UniProt ID | Q8N687 |
| Refseq Size | 709 |
| Cytogenetics | 20p13 |
| Refseq ORF | 468 |
| Synonyms | DEFB-25 |
| Summary | Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeq, Nov 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407046 | DEFB125 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407046 | Transient overexpression lysate of defensin, beta 125 (DEFB125) |
CNY 3080.00 |
|
| PH312030 | DEFB125 MS Standard C13 and N15-labeled recombinant protein (NP_697020) |
CNY 19520.00 |
其它DEFB125产品
