PAX2 (NM_003987) Human Recombinant Protein
CAT#: TP312051
Recombinant protein of human paired box 2 (PAX2), transcript variant a, 20 µg
View other "PAX2" proteins (19)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212051 representing NM_003987
Red=Cloning site Green=Tags(s) MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYT DPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQAS EHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRSAPAAAAAAYDRH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003978 |
Locus ID | 5076 |
UniProt ID | Q02962 |
Refseq Size | 4276 |
Cytogenetics | 10q24.31 |
Refseq ORF | 1248 |
Synonyms | FSGS7; PAPRS |
Summary | PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400106 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418300 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC418301 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418302 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418303 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC429172 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400106 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant b |
CNY 3080.00 |
|
LY418300 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a |
CNY 4840.00 |
|
LY418301 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant c |
CNY 3080.00 |
|
LY418302 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant d |
CNY 3080.00 |
|
LY418303 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant e |
CNY 4840.00 |
|
LY429172 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a |
CNY 3080.00 |
|
PH312051 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978) |
CNY 19520.00 |
|
PH312112 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269) |
CNY 19520.00 |
|
PH318386 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003979) |
CNY 19520.00 |
|
TP312112 | Recombinant protein of human paired box 2 (PAX2), transcript variant b, 20 µg |
CNY 2900.00 |
|
TP318386 | Recombinant protein of human paired box 2 (PAX2), transcript variant c, 20 µg |
CNY 2900.00 |
|
TP750191 | Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Phe147-Val235, tag free, expressed in E.coli, 50ug |
CNY 2840.00 |
|
TP762411 | Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Arg266-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |