AMPD3 (NM_000480) Human Recombinant Protein
CAT#: TP312077
Recombinant protein of human adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 1, 20 µg
View other "AMPD3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212077 representing NM_000480
Red=Cloning site Green=Tags(s) MALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQK ELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPEFQ RVTISGDYCAGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQYLGHPRADTAPPEEGLPDFHPP PLPQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTK TYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEP DRTVAEKRGRKITLRQVFDGLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENY LGGEYFARMVKEVARELEESKYQYSEPRLSIYGRSPEEWPNLAYWFIQHKVYSPNMRWIIQVPRIYDIFR SKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPNPDVWTSEQ NPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYL YYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTC DLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEE ITALTN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 89.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000471 |
| Locus ID | 272 |
| UniProt ID | Q01432 |
| Refseq Size | 4371 |
| Cytogenetics | 11p15.4 |
| Refseq ORF | 2328 |
| Summary | This gene encodes a member of the AMP deaminase gene family. The encoded protein is a highly regulated enzyme that catalyzes the hydrolytic deamination of adenosine monophosphate to inosine monophosphate, a branch point in the adenylate catabolic pathway. This gene encodes the erythrocyte (E) isoforms, whereas other family members encode isoforms that predominate in muscle (M) and liver (L) cells. Mutations in this gene lead to the clinically asymptomatic, autosomal recessive condition erythrocyte AMP deaminase deficiency. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422441 | AMPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424690 | AMPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY422441 | Transient overexpression lysate of adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 3 |
CNY 4840.00 |
|
| LY424690 | Transient overexpression lysate of adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 1 |
CNY 4840.00 |
|
| PH312077 | AMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_000471) |
CNY 14250.00 |
|
| PH324327 | AMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_001020561) |
CNY 19520.00 |
|
| TP324327 | Recombinant protein of human adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 3, 20 µg |
CNY 2900.00 |
