JNK2 (MAPK9) (NM_139070) Human Recombinant Protein
CAT#: TP312273
Recombinant protein of human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b2, 20 µg
View other "JNK2" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212273 representing NM_139070
Red=Cloning site Green=Tags(s) MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRA YRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIK HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWS VGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIF PSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIE EWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL EGCR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620709 |
Locus ID | 5601 |
UniProt ID | P45984 |
Refseq Size | 1942 |
Cytogenetics | 5q35.3 |
Refseq ORF | 1272 |
Synonyms | JNK-55; JNK2; JNK2A; JNK2ALPHA; JNK2B; JNK2BETA; p54a; p54aSAPK; PRKM9; SAPK; SAPK1a |
Summary | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase |
Protein Pathways | Adipocytokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, GnRH signaling pathway, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400972 | MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408411 | MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408412 | MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408413 | MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400972 | Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2 |
CNY 3080.00 |
|
LY408411 | Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1 |
CNY 3080.00 |
|
LY408412 | Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1 |
CNY 3080.00 |
|
LY408413 | Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b2 |
CNY 4840.00 |
|
PH307608 | MAPK9 MS Standard C13 and N15-labeled recombinant protein (NP_620707) |
CNY 19520.00 |
|
PH312273 | MAPK9 MS Standard C13 and N15-labeled recombinant protein (NP_620709) |
CNY 19520.00 |
|
PH312814 | MAPK9 MS Standard C13 and N15-labeled recombinant protein (NP_002743) |
CNY 19520.00 |
|
TP307608 | Recombinant protein of human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1, 20 µg |
CNY 2900.00 |
|
TP312814 | Recombinant protein of human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2, 20 µg |
CNY 2900.00 |
|
TP761541 | Purified recombinant protein of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |