Myoglobin (MB) (NM_005368) Human Recombinant Protein
CAT#: TP312352
Recombinant protein of human myoglobin (MB), transcript variant 1, 20 µg
View other "Myoglobin" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212352 representing NM_005368
Red=Cloning site Green=Tags(s) MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR KDMASNYKELGFQG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005359 |
Locus ID | 4151 |
UniProt ID | P02144 |
Refseq Size | 1078 |
Cytogenetics | 22q12.3 |
Refseq ORF | 462 |
Synonyms | PVALB |
Summary | This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. [provided by RefSeq, May 2020] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Calmodulin activates the Hippo signaling pathway by promoting LATS1 kinase–mediated inhibitory phosphorylation of the transcriptional coactivator YAP
,null,
The Journal of Biological Chemistry
,PubMed ID 35307353
[MB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404319 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404320 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417346 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404319 | Transient overexpression lysate of myoglobin (MB), transcript variant 2 |
CNY 3080.00 |
|
LY404320 | Transient overexpression lysate of myoglobin (MB), transcript variant 3 |
CNY 3080.00 |
|
LY417346 | Transient overexpression lysate of myoglobin (MB), transcript variant 1 |
CNY 3080.00 |
|
PH303113 | MB MS Standard C13 and N15-labeled recombinant protein (NP_976312) |
CNY 19520.00 |
|
PH312352 | MB MS Standard C13 and N15-labeled recombinant protein (NP_005359) |
CNY 19520.00 |
|
TP303113 | Recombinant protein of human myoglobin (MB), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP761636 | Purified recombinant protein of Human myoglobin (MB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Myoglobin产品