Menin (MEN1) (NM_130799) Human Recombinant Protein
CAT#: TP312368
Recombinant protein of human multiple endocrine neoplasia I (MEN1), transcript variant 2, 20 µg
View other "Menin" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212368 representing NM_130799
Red=Cloning site Green=Tags(s) MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPD PPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHI QSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQT VNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMAL GNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQD YNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGI CKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPE EPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTFQSEKMKG MKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 67.3 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_570711 |
| Locus ID | 4221 |
| UniProt ID | O00255 |
| Refseq Size | 2772 |
| Cytogenetics | 11q13.1 |
| Refseq ORF | 1830 |
| Synonyms | MEAI; SCG2 |
| Summary | This gene encodes menin, a tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. Menin is a scaffold protein that functions in histone modification and epigenetic gene regulation. It is thought to regulate several pathways and processes by altering chromatin structure through the modification of histones. [provided by RefSeq, May 2019] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408952 | MEN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC408955 | MEN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408952 | Transient overexpression lysate of multiple endocrine neoplasia I (MEN1), transcript variant 2 |
CNY 4840.00 |
|
| LY408955 | Transient overexpression lysate of multiple endocrine neoplasia I (MEN1), transcript variant e1D |
CNY 4840.00 |
|
| PH312368 | MEN1 MS Standard C13 and N15-labeled recombinant protein (NP_570711) |
CNY 19520.00 |
