MADCAM1 (NM_130762) Human Recombinant Protein
CAT#: TP312381
Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2, 20 µg
View other "MADCAM1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212381 representing NM_130762
Red=Cloning site Green=Tags(s) MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAV QSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVT PVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRL PGLELSHRQAIPASKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLRLLPQVSA WAGLRGTGQVGISPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_570118 |
| Locus ID | 8174 |
| UniProt ID | Q13477 |
| Refseq Size | 1275 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 885 |
| Synonyms | MACAM1 |
| Summary | The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408927 | MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408928 | MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408927 | Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1 |
CNY 3080.00 |
|
| LY408928 | Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2 |
CNY 3080.00 |
|
| PH312381 | MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570118) |
CNY 19520.00 |
|
| PH319060 | MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570116) |
CNY 19520.00 |
|
| TP319060 | Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它MADCAM1产品
