CCDC149 (NM_173463) Human Recombinant Protein
CAT#: TP312457
Recombinant protein of human coiled-coil domain containing 149 (CCDC149), transcript variant 1, 20 µg
View other "CCDC149" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212457 representing NM_173463
Red=Cloning site Green=Tags(s) MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKL LRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERL NQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKSSSSAL TGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_775734 |
| Locus ID | 91050 |
| UniProt ID | Q6ZUS6 |
| Refseq Size | 5606 |
| Cytogenetics | 4p15.2 |
| Refseq ORF | 801 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406617 | CCDC149 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427269 | CCDC149 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406617 | Transient overexpression lysate of coiled-coil domain containing 149 (CCDC149), transcript variant 1 |
CNY 3080.00 |
|
| LY427269 | Transient overexpression lysate of coiled-coil domain containing 149 (CCDC149), transcript variant 2 |
CNY 3080.00 |
|
| PH312457 | CCDC149 MS Standard C13 and N15-labeled recombinant protein (NP_775734) |
CNY 19520.00 |
|
| PH325905 | CCDC149 MS Standard C13 and N15-labeled recombinant protein (NP_001124198) |
CNY 19520.00 |
|
| TP325905 | Recombinant protein of human coiled-coil domain containing 149 (CCDC149), transcript variant 2, 20 µg |
CNY 2900.00 |
其它CCDC149产品
