IRF5 (NM_002200) Human Recombinant Protein
CAT＃: TP312461
Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 1, 20 µg
View other "IRF5" proteins (28)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212461 protein sequence
Red=Cloning site Green=Tags(s) MGGRRVRWEVYISRARLVNRQNFVIRLTIGRPGIRRLDPVPRRSAAAIAMNQSIPVAPTPPRRVRLKPWL VAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLR CALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTE DVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAG EQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPS PEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFS LEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSI RLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 26519527) |
| Reference Data | |
| RefSeq | NP_002191 |
| Locus ID | 3663 |
| UniProt ID | Q13568 |
| Refseq Size | 2870 |
| Cytogenetics | 7q32.1 |
| Refseq ORF | 1641 |
| Synonyms | interferon regulatory factor 5; SLEB10 |
| Summary | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Dec 2016] |
| Protein Families | Transcription Factors |
| Protein Pathways | Toll-like receptor signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Sex Differences in Plasmacytoid Dendritic Cell Levels of IRF5 Drive Higher IFN-a Production in Women
,Griesbeck, M;Ziegler, S;Laffont, S;Smith, N;Chauveau, L;Tomezsko, P;Sharei, A;Kourjian, G;Porichis, F;Hart, M;Palmer, CD;Sirignano, M;Beisel, C;Hildebrandt, H;Cénac, C;Villani, AC;Diefenbach, TJ;Le Gall, S;Schwartz, O;Herbeuval, JP;Autran, B;Guéry, JC;Chang, JJ;Altfeld, M;,
J. Immunol.
,PubMed ID 26519527
[IRF5]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403185 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419472 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420650 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420651 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420652 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420653 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420654 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426034 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403185 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 |
CNY 3080.00 |
|
| LY419472 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 1 |
CNY 4840.00 |
|
| LY420650 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 |
CNY 4840.00 |
|
| LY420651 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 4 |
CNY 4840.00 |
|
| LY420652 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 |
CNY 4840.00 |
|
| LY420653 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 |
CNY 4840.00 |
|
| LY420654 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 |
CNY 4840.00 |
|
| PH300458 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_116032) |
CNY 19520.00 |
|
| PH311941 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092099) |
CNY 14250.00 |
|
| PH312461 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_002191) |
CNY 19520.00 |
|
| PH315434 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092097) |
CNY 19520.00 |
|
| PH315781 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092100) |
CNY 19520.00 |
|
| PH316039 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092101) |
CNY 14250.00 |
|
| PH316505 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092098) |
CNY 19520.00 |
|
| TP300458 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP311941 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP315434 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP315781 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP316039 | Purified recombinant protein of Homo sapiens interferon regulatory factor 5 (IRF5), transcript variant 7, 20 µg |
CNY 2900.00 |
|
| TP316505 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 4, 20 µg |
CNY 2900.00 |
