SERINC3 (NM_006811) Human Recombinant Protein
CAT#: TP312480
Recombinant protein of human serine incorporator 3 (SERINC3), transcript variant 1, 20 µg
View other "SERINC3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212480 representing NM_006811
Red=Cloning site Green=Tags(s) MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPG FCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAA LIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFT SAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTM YLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLY SSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIM MTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006802 |
| Locus ID | 10955 |
| UniProt ID | Q13530 |
| Refseq Size | 2592 |
| Cytogenetics | 20q13.12 |
| Refseq ORF | 1419 |
| Synonyms | AIGP1; DIFF33; SBBI99; TDE; TDE1; TMS-1 |
| Summary | Restriction factor required to restrict infectivity of lentiviruses, such as HIV-1: acts by inhibiting an early step of viral infection. Impairs the penetration of the viral particle into the cytoplasm (PubMed:26416733, PubMed:26416734).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402036 | SERINC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404656 | SERINC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402036 | Transient overexpression lysate of serine incorporator 3 (SERINC3), transcript variant 1 |
CNY 3080.00 |
|
| LY404656 | Transient overexpression lysate of serine incorporator 3 (SERINC3), transcript variant 2 |
CNY 3080.00 |
|
| PH312480 | SERINC3 MS Standard C13 and N15-labeled recombinant protein (NP_006802) |
CNY 19520.00 |
其它SERINC3产品
