MNX1 (NM_005515) Human Recombinant Protein
CAT#: TP312606
Recombinant protein of human motor neuron and pancreas homeobox 1 (MNX1), 20 µg
View other "MNX1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212606 representing NM_005515
Red=Cloning site Green=Tags(s) MEKSKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPA DRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLALG LHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQL DQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLML TETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD LRDSDPEEDEDEDDEDHFPYSNGASVHAASSDCSSEDDSPPPRPSHQPAPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005506 |
| Locus ID | 3110 |
| UniProt ID | P50219 |
| Refseq Size | 2176 |
| Cytogenetics | 7q36.3 |
| Refseq ORF | 1203 |
| Synonyms | HB9; HLXB9; HOXHB9; SCRA1 |
| Summary | This gene encodes a nuclear protein, which contains a homeobox domain and is a transcription factor. Mutations in this gene result in Currarino syndrome, an autosomic dominant congenital malformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
| Protein Pathways | Maturity onset diabetes of the young |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401692 | MNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401692 | Transient overexpression lysate of motor neuron and pancreas homeobox 1 (MNX1), transcript variant 1 |
CNY 3080.00 |
|
| PH312606 | MNX1 MS Standard C13 and N15-labeled recombinant protein (NP_005506) |
CNY 19520.00 |
