DDT (NM_001084392) Human Recombinant Protein
CAT#: TP312637
Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 2, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212637 protein sequence
Red=Cloning site Green=Tags(s) MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001077861 |
| Locus ID | 1652 |
| UniProt ID | P30046 |
| Refseq Size | 637 |
| Cytogenetics | 22q11.23 |
| Refseq ORF | 354 |
| Synonyms | D-DT; DDCT; MIF-2; MIF2 |
| Summary | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419969 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421266 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425972 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419969 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 1 |
CNY 3080.00 |
|
| LY421266 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 2 |
CNY 3080.00 |
|
| PH302047 | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346) |
CNY 19520.00 |
|
| PH312637 | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861) |
CNY 19520.00 |
|
| TP302047 | Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 1, 20 µg |
CNY 2900.00 |
