ICAM2 (NM_001099787) Human Recombinant Protein
CAT#: TP312720
Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 2, 20 µg
View other "ICAM2" proteins (20)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212720 representing NM_001099787
Red=Cloning site Green=Tags(s) MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001093257 |
| Locus ID | 3384 |
| UniProt ID | P13598 |
| Refseq Size | 1270 |
| Cytogenetics | 17q23.3 |
| Refseq ORF | 825 |
| Synonyms | CD102 |
| Summary | The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420535 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420536 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420537 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420538 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424476 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426090 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426091 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420535 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 1 |
CNY 3080.00 |
|
| LY420536 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 2 |
CNY 3080.00 |
|
| LY420537 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 3 |
CNY 3080.00 |
|
| LY420538 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 4 |
CNY 3080.00 |
|
| LY424476 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 5 |
CNY 3080.00 |
|
| PH300459 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000864) |
CNY 19520.00 |
|
| PH312720 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093257) |
CNY 14250.00 |
|
| PH312775 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093259) |
CNY 14250.00 |
|
| PH316706 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093258) |
CNY 14250.00 |
|
| TP300459 | Recombinant protein of human intercellular adhesion molecule 2 (ICAM2), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP312775 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP316706 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720626 | Purified recombinant protein of Human intercellular adhesion molecule 2 (ICAM2), transcript variant 5 |
CNY 1800.00 |
