BAG5 (NM_001015048) Human Recombinant Protein
CAT#: TP312765
Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 3, 20 µg
View other "BAG5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212765 protein sequence
Red=Cloning site Green=Tags(s) MRFHWLPTLSEPFDRNQELETCIRPLWTPSGSACETEHNKSMDMGNQHPSISRLQEIQKEVKSVEQQVIG FSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNANHPHRIEIQNIFE EAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTGGKISLRKARYHTLTKICAVQEIIEDCMKK QPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNNETCRHLSCVLSGLIADLDALDVCGRTEIR NYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQNPSELYLSSKTE LQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKEALEKRKLFACEEHPSHKAVWNVLGNLSEI QGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001015048 |
| Locus ID | 9529 |
| UniProt ID | Q9UL15 |
| Refseq Size | 4866 |
| Cytogenetics | 14q32.33 |
| Refseq ORF | 1464 |
| Synonyms | BAG-5 |
| Summary | The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417691 | BAG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423114 | BAG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY417691 | Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 2 |
CNY 3080.00 |
|
| LY423114 | Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 3 |
CNY 4840.00 |
|
| PH308518 | BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_004864) |
CNY 19520.00 |
|
| PH312765 | BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_001015048) |
CNY 19520.00 |
|
| TP308518 | Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 2, 20 µg |
CNY 2900.00 |
