METTL1 (NM_005371) Human Recombinant Protein
CAT#: TP312768
Recombinant protein of human methyltransferase like 1 (METTL1), transcript variant 1, 20 µg
View other "METTL1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212768 representing NM_005371
Red=Cloning site Green=Tags(s) MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKK EKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSN AMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTH FEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005362 |
Locus ID | 4234 |
UniProt ID | Q9UBP6 |
Refseq Size | 1743 |
Cytogenetics | 12q14.1 |
Refseq ORF | 828 |
Synonyms | C12orf1; TRM8; TRMT8; YDL201w |
Summary | This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411493 | METTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417349 | METTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411493 | Transient overexpression lysate of methyltransferase like 1 (METTL1), transcript variant 3 |
CNY 3080.00 |
|
LY417349 | Transient overexpression lysate of methyltransferase like 1 (METTL1), transcript variant 1 |
CNY 3080.00 |
|
PH312768 | METTL1 MS Standard C13 and N15-labeled recombinant protein (NP_005362) |
CNY 19520.00 |