SCYL1BP1 (GORAB) (NM_152281) Human Recombinant Protein
CAT#: TP312883
Recombinant protein of human golgin, RAB6-interacting (GORAB), 20 µg
View other "SCYL1BP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212883 representing NM_152281
Red=Cloning site Green=Tags(s) MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALV EQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENS HDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKL KRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTI IQQNELRKAKKLEELMQQLDVEADEETLELEVEVERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKE NRKCQEQAVSPKVDDQCGNSSSIPFLSPNCPNQEGNDISAALAT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689494 |
| Locus ID | 92344 |
| UniProt ID | Q5T7V8 |
| Refseq Size | 2186 |
| Cytogenetics | 1q24.2 |
| Refseq ORF | 1182 |
| Synonyms | GO; NTKLBP1; SCYL1BP1 |
| Summary | This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407701 | GORAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407701 | Transient overexpression lysate of golgin, RAB6-interacting (GORAB), transcript variant 1 |
CNY 3080.00 |
|
| PH312883 | GORAB MS Standard C13 and N15-labeled recombinant protein (NP_689494) |
CNY 19520.00 |
其它SCYL1BP1产品
