C1ORF151 (MINOS1) (NM_001032363) Human Recombinant Protein
CAT#: TP312930
Recombinant protein of human chromosome 1 open reading frame 151 (C1orf151), 20 µg
View other "C1ORF151" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212930 protein sequence
Red=Cloning site Green=Tags(s) MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG KYVKEQEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 8.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001027535 |
| Locus ID | 440574 |
| UniProt ID | Q5TGZ0 |
| Refseq Size | 3726 |
| Cytogenetics | 1p36.13 |
| Refseq ORF | 234 |
| Synonyms | C1orf151; Mic10; MINOS1; MIO10 |
| Summary | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422307 | MINOS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422307 | Transient overexpression lysate of chromosome 1 open reading frame 151 (C1orf151) |
CNY 3080.00 |
|
| PH312930 | C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535) |
CNY 19520.00 |
其它C1ORF151产品
