DNMT3A (NM_022552) Human Recombinant Protein
CAT#: TP313064
Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, 20 µg
View other "DNMT3A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213064 protein sequence
Red=Cloning site Green=Tags(s) MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPA VISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPK EGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARW KREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDD EPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSF CSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNI EDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCV ECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEK RKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGP FDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDIS RFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFA CV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 101.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | DNMT3A activity verified in a biochemical assay: DNMT3A (DNA (cytosine-5-)-methyltransferase 3 alpha) (TP313064) is a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. It modifies DNA in a non-processive manner and also methylates non-CpG sites. Varying concentrations of DNMT3A were added to a microplate containing a bound methyltransferase substrate. After incubation, the resulting methylated DNA residues were detected immunologically and a colorimetric signal was generated and measured. Surface Plasmon Ressonance (SPR) (PMID: 27468168) |
Reference Data | |
RefSeq | NP_072046 |
Locus ID | 1788 |
UniProt ID | Q9Y6K1 |
Refseq Size | 4324 |
Cytogenetics | 2p23.3 |
Refseq ORF | 2736 |
Synonyms | DNMT3A2; HESJAS; M.HsaIIIA; TBRS |
Summary | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
DNA G-quadruplexes show strong interaction with DNA methyltransferases in vitro
,Cree, SL;Fredericks, R;Miller, A;Pearce, FG;Filichev, V;Fee, C;Kennedy, MA;,
FEBS Lett.
,PubMed ID 27468168
[DNMT3A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411621 | DNMT3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY411621 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3 |
CNY 4840.00 |
|
PH313064 | DNMT3A MS Standard C13 and N15-labeled recombinant protein (NP_072046) |
CNY 19520.00 |