C8orf42 (TDRP) (NM_175075) Human Recombinant Protein
CAT#: TP313199
Recombinant protein of human chromosome 8 open reading frame 42 (C8orf42), 20 µg
View other "C8orf42" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213199 representing NM_175075
Red=Cloning site Green=Tags(s) MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGA RLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSP KSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWE DDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_778250 |
| Locus ID | 157695 |
| UniProt ID | Q86YL5 |
| Refseq Size | 1901 |
| Cytogenetics | 8p23.3 |
| Refseq ORF | 774 |
| Synonyms | C8orf42; Inm01; TDRP1; TDRP2 |
| Summary | Contributes to normal sperm motility, but not essential for male fertility.[UniProtKB/Swiss-Prot Function] |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Immuno-moodulin: a new anxiogenic factor produced by Annexin-A1 transgenic autoimmune-prone T cells
,Piras, G;Rattazzi, L;Paschalidis, N;Oggero, S;Berti, G;Ono, M;Bellia, F;D'Addario, C;Dell'Osso, B;Maria Pariante, C;Perretti, M;D'Acquisto, F;,
Brain, Behavior, and Immunity
,PubMed ID 32126289
[TDRP]
|
|
Immuno-moodulin: a new anxiogenic factor produced by autoimmune-prone T cells
,Piras, G;Rattazzi, L;Paschalidis, N;Oggero, S;Berti, G;,
bioRxiv
[TDRP]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406313 | TDRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406313 | Transient overexpression lysate of chromosome 8 open reading frame 42 (C8orf42) |
CNY 3080.00 |
|
| PH313199 | C8orf42 MS Standard C13 and N15-labeled recombinant protein (NP_778250) |
CNY 19520.00 |
其它C8orf42产品
