ACPL2 (PXYLP1) (NM_001037172) Human Recombinant Protein
CAT#: TP313267
Purified recombinant protein of Homo sapiens acid phosphatase-like 2 (ACPL2), transcript variant 2, 20 µg
View other "ACPL2" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213267 protein sequence
Red=Cloning site Green=Tags(s) MLFRNRFLLLLALAALLAFVSLSLQFFHLIPVSTPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNI PSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGS GASFESPLNSLPLYPNHPLCEMGELTQTGVVQHLQNGQLLRDIYLKKHKLLPNDWSADQLYLETTGKSRT LQSGLALLYGFLPDFDWKKIYFRHQPSALFCSGSCYCPVRNQYLEKEQRRQYLLRLKNSQLEKTYGEMAK IVDVPTKQLRAANPIDSMLCHFCHNVSFPCTRNGCVDMEHFKVIKTHQIEDERERREKKLYFGYSLLGAH PILNQTIGRMQRATEGRKEELFALYSAHDVTLSPVLSALGLSEARFPRFAARLIFELWQDREKPSEHSVR ILYNGVDVTFHTSFCQDHHKRSPKPMCPLENLVRFVKRDMFVALGGSGTNYYDACHREGF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001032249 |
| Locus ID | 92370 |
| UniProt ID | Q8TE99 |
| Refseq Size | 3281 |
| Cytogenetics | 3q23 |
| Refseq ORF | 1440 |
| Synonyms | ACPL2; HEL124; XYLP |
| Summary | Responsible for the 2-O-dephosphorylation of xylose in the glycosaminoglycan-protein linkage region of proteoglycans thereby regulating the amount of mature glycosaminoglycan (GAG) chains. Sulfated glycosaminoglycans (GAGs), including heparan sulfate and chondroitin sulfate, are synthesized on the so-called common GAG-protein linkage region (GlcUAbeta1-3Galbeta1-3Galbeta1-4Xylbeta1-O-Ser) of core proteins, which is formed by the stepwise addition of monosaccharide residues by the respective specific glycosyltransferases. Xylose 2-O-dephosphorylation during completion of linkage region formation is a prerequisite for the initiation and efficient elongation of the repeating disaccharide region of GAG chains.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403459 | PXYLP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421929 | PXYLP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403459 | Transient overexpression lysate of acid phosphatase-like 2 (ACPL2), transcript variant 1 |
CNY 3080.00 |
|
| LY421929 | Transient overexpression lysate of acid phosphatase-like 2 (ACPL2), transcript variant 2 |
CNY 4840.00 |
|
| PH313267 | ACPL2 MS Standard C13 and N15-labeled recombinant protein (NP_001032249) |
CNY 14250.00 |
|
| TP762548 | Purified recombinant protein of Human acid phosphatase-like 2 (ACPL2), transcript variant 1, 50ug |
CNY 2480.00 |
