Plunc (BPIFA1) (NM_016583) Human Recombinant Protein
CAT#: TP313322
Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 1, 20 µg
View other "Plunc" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213322 representing NM_016583
Red=Cloning site Green=Tags(s) MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057667 |
| Locus ID | 51297 |
| UniProt ID | Q9NP55 |
| Refseq Size | 1049 |
| Cytogenetics | 20q11.21 |
| Refseq ORF | 768 |
| Synonyms | bA49G10.5; LUNX; NASG; PLUNC; SPLUNC1; SPURT |
| Summary | This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known. [provided by RefSeq, Aug 2014] |
| Protein Families | Secreted Protein |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Anti-BPIFA1/SPLUNC1: A new autoantibody prevalent in patients with endstage cystic fibrosis
,Budding, K;van de Graaf, EA;Hoefnagel, T;,
Journal of Cystic Fibrosis 23 October 2013
[BPIFA1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402569 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408781 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402569 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 1 |
CNY 3080.00 |
|
| LY408781 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 2 |
CNY 3080.00 |
|
| PH303060 | PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913) |
CNY 19520.00 |
|
| PH313322 | PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_057667) |
CNY 19520.00 |
|
| TP303060 | Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 2, 20 µg |
CNY 2900.00 |
