AIRE (NM_000383) Human Recombinant Protein
CAT#: TP313497
Recombinant protein of human autoimmune regulator (AIRE), transcript variant AIRE-1, 20 µg
View other "AIRE" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213497 representing NM_000383
Red=Cloning site Green=Tags(s) MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQD STAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARA AAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGIL IQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVP APLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQP RAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCV GPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAP SPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000374 |
| Locus ID | 326 |
| UniProt ID | O43918 |
| Refseq Size | 2252 |
| Cytogenetics | 21q22.3 |
| Refseq ORF | 1635 |
| Synonyms | AIRE1; APECED; APS1; APSI; PGA1 |
| Summary | This gene encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CREB binding protein. The encoded protein plays an important role in immunity by regulating the expression of autoantigens and negative selection of autoreactive T-cells in the thymus. Mutations in this gene cause the rare autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy with candidiasis and ectodermal dystrophy (APECED). [provided by RefSeq, Jun 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Primary immunodeficiency, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424585 | AIRE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424752 | AIRE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY424585 | Transient overexpression lysate of autoimmune regulator (AIRE), transcript variant AIRE-2 |
CNY 3080.00 |
|
| LY424752 | Transient overexpression lysate of autoimmune regulator (AIRE), transcript variant AIRE-1 |
CNY 4840.00 |
|
| PH313497 | AIRE MS Standard C13 and N15-labeled recombinant protein (NP_000374) |
CNY 14250.00 |
