MIPOL 1 (MIPOL1) (NM_138731) Human Recombinant Protein
CAT#: TP313582
Recombinant protein of human mirror-image polydactyly 1 (MIPOL1), 20 µg
View other "MIPOL 1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213582 representing NM_138731
Red=Cloning site Green=Tags(s) MENWSKDITHSYLEQETTGINKSTQPDEQLTMNSEKSMHRKSTELVNEITCENTEWPGQRSTNFQIISSY PDDESVYCTTEKYNVMEHRHNDMHYECMTPCQVTSDSDKEKTIAFLLKELDILRTSNKKLQQKLAKEDKE QRKLKFKLELQEKETEAKIAEKTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLE NINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRL EQELHHVKEQNQTSANNMRHLTAENNQERALKAKLLSMQQARETAVQQYKKLEEEIQTLRVYYSLHKSLS QEENLKDQFNYTLSTYEEALKNRENIVSITQQQNEELATQLQQALTERANMELQLQHAREASQVANEKVQ KLERLVDVLRKKVGTGTMRTVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_620059 |
| Locus ID | 145282 |
| UniProt ID | Q8TD10 |
| Refseq Size | 6103 |
| Cytogenetics | 14q13.3-q21.1 |
| Refseq ORF | 1326 |
| Synonyms | CCDC193 |
| Summary | This gene encodes a coiled-coil domain-containing protein. The encoded protein may function as a tumor suppressor. A translocation that results in truncation of the protein encoded by this locus has been associated with mirror-image polydactyly, also known as Laurin-Sandrow Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Sep 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408538 | MIPOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408538 | Transient overexpression lysate of mirror-image polydactyly 1 (MIPOL1) |
CNY 4840.00 |
|
| PH313582 | MIPOL1 MS Standard C13 and N15-labeled recombinant protein (NP_620059) |
CNY 19520.00 |
其它MIPOL 1产品

