Pannexin 2 (PANX2) (NM_052839) Human Recombinant Protein
CAT#: TP313641
Recombinant protein of human pannexin 2 (PANX2), 20 µg
View other "Pannexin 2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213641 representing NM_052839
Red=Cloning site Green=Tags(s) MHHLLEQSADMATALLAGEKLRELILPGAQDDKAGALAALLLQLKLELPFDRVVTIGTVLVPILLVTLVF TKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFEHKFLPYALLAFAAIMYVPAL GWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKREIIENAEKEKSPEQNLF EKYLERRGRSNFLAKLYLARHVLILLLSAVPISYLCTYYATQKQNEFTCALGASPDGAAGAGPAVRVSCK LPSVQLQRIIAGVDIVLLCVMNLIILVNLIHLFIFRKSNFIFDKLHKVGIKTRRQWRRSQFCDINILAMF CNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEP PVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATDTLIAPLLDRSAHHYKGGGGD PGPGPAPAPAPPPAPDKKHARHFSLDVHPYILGTKKAKAEAVPAALPASRSQEGGFLSQAEDCGLGLAPA PIKDAPLPEKEIPYPTEPARAGLPSGGPFHVRSPPAAPAVAPLTPASLGKAEPLTILSRNATHPLLHINT LYEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 74.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_443071 |
| Locus ID | 56666 |
| UniProt ID | Q96RD6 |
| Refseq Size | 3069 |
| Cytogenetics | 22q13.33 |
| Refseq ORF | 2031 |
| Synonyms | hPANX2; PX2 |
| Summary | The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nervous system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409450 | PANX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431543 | PANX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409450 | Transient overexpression lysate of pannexin 2 (PANX2), transcript variant 1 |
CNY 4840.00 |
|
| LY431543 | Transient overexpression lysate of pannexin 2 (PANX2), transcript variant 2 |
CNY 3080.00 |
|
| PH313641 | PANX2 MS Standard C13 and N15-labeled recombinant protein (NP_443071) |
CNY 19520.00 |
其它Pannexin 2产品
