BEX4 (NM_001080425) Human Recombinant Protein
CAT#: TP313659
Recombinant protein of human brain expressed, X-linked 4 (BEX4), transcript variant 2, 20 µg
View other "BEX4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213659 representing NM_001080425
Red=Cloning site Green=Tags(s) MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001073894 |
Locus ID | 56271 |
UniProt ID | Q9NWD9 |
Refseq Size | 1245 |
Cytogenetics | Xq22.1 |
Refseq ORF | 360 |
Synonyms | BEXL1 |
Summary | This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421642 | BEX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421642 | Transient overexpression lysate of brain expressed, X-linked 4 (BEX4), transcript variant 2 |
CNY 3080.00 |
|
PH313659 | BEX4 MS Standard C13 and N15-labeled recombinant protein (NP_001073894) |
CNY 19520.00 |