FAM9B (NM_205849) Human Recombinant Protein
CAT#: TP313736M
Recombinant protein of human family with sequence similarity 9, member B (FAM9B), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 6281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213736 representing NM_205849
Red=Cloning site Green=Tags(s) MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRM KMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKK WQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_995321 |
Locus ID | 171483 |
UniProt ID | Q8IZU0 |
Refseq Size | 1339 |
Cytogenetics | Xp22.31 |
Refseq ORF | 558 |
Synonyms | TEX39B |
Summary | This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |