CTRP3 (C1QTNF3) (NM_181435) Human Recombinant Protein
CAT#: TP313742
Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2, 20 µg
View other "CTRP3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213742 representing NM_181435
Red=Cloning site Green=Tags(s) MLWRQLIYWQLLALFFLPFCLCQDEYMEVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDN NTSTDLKSLRPDELPHPEVDDLAQITTFWGQSPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGN HGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIF SSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNH AVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_852100 |
Locus ID | 114899 |
UniProt ID | Q9BXJ4 |
Refseq Size | 3789 |
Cytogenetics | 5p13.2 |
Refseq ORF | 957 |
Synonyms | C1ATNF3; CORCS; CORS; CORS-26; CORS26; CTRP3 |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405756 | C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410641 | C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405756 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 |
CNY 3080.00 |
|
LY410641 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1 |
CNY 3080.00 |
|
PH311047 | C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_112207) |
CNY 19520.00 |
|
PH313742 | C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) |
CNY 19520.00 |
|
TP311047 | Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1, 20 µg |
CNY 2900.00 |