OSBPL3 (NM_145322) Human Recombinant Protein
CAT＃: TP313784
Recombinant protein of human oxysterol binding protein-like 3 (OSBPL3), transcript variant 4, 20 µg
View other "OSBPL3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
热销推荐CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213784 representing NM_145322
Red=Cloning site Green=Tags(s) MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWH KRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSK LRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVP LWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQVPKPFSGPVRLHSSNPNLSTL DFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLK NALSSENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNL SNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQ RLCEELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNPVLGETYECIREDKGFQFFSE QVSHHPPISACHAESRNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQ RWIEHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSA CVWRANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQR ERRRVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 93.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_663162 |
| Locus ID | 26031 |
| UniProt ID | Q9H4L5 |
| Refseq Size | 6529 |
| Cytogenetics | 7p15.3 |
| Refseq ORF | 2460 |
| Synonyms | ORP-3; ORP3; OSBP3 |
| Summary | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. The encoded protein is involved in the regulation of cell adhesion and organization of the actin cytoskeleton. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407964 | OSBPL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407966 | OSBPL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC414466 | OSBPL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407964 | Transient overexpression lysate of oxysterol binding protein-like 3 (OSBPL3), transcript variant 2 |
CNY 4840.00 |
|
| LY407966 | Transient overexpression lysate of oxysterol binding protein-like 3 (OSBPL3), transcript variant 4 |
CNY 4840.00 |
|
| LY414466 | Transient overexpression lysate of oxysterol binding protein-like 3 (OSBPL3), transcript variant 1 |
CNY 3080.00 |
|
| PH313732 | OSBPL3 MS Standard C13 and N15-labeled recombinant protein (NP_663161) |
CNY 19520.00 |
|
| PH313784 | OSBPL3 MS Standard C13 and N15-labeled recombinant protein (NP_663162) |
CNY 19520.00 |
|
| TP313732 | Recombinant protein of human oxysterol binding protein-like 3 (OSBPL3), transcript variant 3, 20 µg |
CNY 2900.00 |
