PICALM (NM_007166) Human Recombinant Protein
CAT#: TP313791
Recombinant protein of human phosphatidylinositol binding clathrin assembly protein (PICALM), transcript variant 1, 20 µg
View other "PICALM" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213791 representing NM_007166
Red=Cloning site Green=Tags(s) MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNS SWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQ VAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAA YNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQ HLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKP HTSLTTAASPVSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD PFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFE SVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKN DVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIY SQPVMRPPNPFGPVSGAQIQFM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro binding assay (PMID: 26005850) |
Reference Data | |
RefSeq | NP_009097 |
Locus ID | 8301 |
UniProt ID | Q13492 |
Refseq Size | 3860 |
Cytogenetics | 11q14.2 |
Refseq ORF | 1956 |
Synonyms | CALM; CLTH; LAP |
Summary | This gene encodes a clathrin assembly protein, which recruits clathrin and adaptor protein complex 2 (AP2) to cell membranes at sites of coated-pit formation and clathrin-vesicle assembly. The protein may be required to determine the amount of membrane to be recycled, possibly by regulating the size of the clathrin cage. The protein is involved in AP2-dependent clathrin-mediated endocytosis at the neuromuscular junction. A chromosomal translocation t(10;11)(p13;q14) leading to the fusion of this gene and the MLLT10 gene is found in acute lymphoblastic leukemia, acute myeloid leukemia and malignant lymphomas. The polymorphisms of this gene are associated with the risk of Alzheimer disease. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Central role for PICALM in amyloid-[beta] blood-brain barrier transcytosis and clearance
,Zhao, Z;Sagare, AP;Ma, Q;Halliday, MR;Kong, P;,
Nature Neuroscience
,PubMed ID 26005850
[PICALM]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416170 | PICALM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416170 | Transient overexpression lysate of phosphatidylinositol binding clathrin assembly protein (PICALM), transcript variant 1 |
CNY 3080.00 |
|
PH313791 | PICALM MS Standard C13 and N15-labeled recombinant protein (NP_009097) |
CNY 19520.00 |