STAT1 (NM_007315) Human Recombinant Protein
CAT#: TP313858
Recombinant protein of human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha, 20 µg
View other "STAT1" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213858 representing NM_007315
Red=Cloning site Green=Tags(s) MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSR FSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQK ELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKR KEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKL EELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK LQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTP PCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIES ILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHA VEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTG YIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 87.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme substrate (PMID: 27796300) |
Reference Data | |
RefSeq | NP_009330 |
Locus ID | 6772 |
UniProt ID | P42224 |
Refseq Size | 4157 |
Cytogenetics | 2q32.2 |
Refseq ORF | 2250 |
Synonyms | CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91 |
Summary | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C. [provided by RefSeq, Jun 2020] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Chemokine signaling pathway, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Toll-like receptor signaling pathway |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage
,null,
Nature Communications
,PubMed ID 35768435
[STAT1]
|
PARP9 and PARP14 cross-regulate macrophage activation via STAT1 ADP-ribosylation
,Iwata, H;Goettsch, C;Sharma, A;Ricchiuto, P;Goh, WW;Halu, A;Yamada, I;Yoshida, H;Hara, T;Wei, M;Inoue, N;Fukuda, D;Mojcher, A;Mattson, PC;Barabási, AL;Boothby, M;Aikawa, E;Singh, SA;Aikawa, M;,
Nat Commun
,PubMed ID 27796300
[STAT1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408329 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416045 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC429341 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY408329 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta |
CNY 3080.00 |
|
LY416045 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha |
CNY 4840.00 |
|
LY429341 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha |
CNY 4840.00 |
|
PH301075 | STAT1 MS Standard C13 and N15-labeled recombinant protein (NP_644671) |
CNY 19520.00 |
|
PH313858 | STAT1 MS Standard C13 and N15-labeled recombinant protein (NP_009330) |
CNY 19520.00 |
|
TP301075 | Recombinant protein of human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta, 20 µg |
CNY 2900.00 |
|
TP720884 | Purified recombinant protein of Human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta |
CNY 1800.00 |