ADPRM (NM_020233) Human Recombinant Protein
CAT#: TP313957
Recombinant protein of human chromosome 17 open reading frame 48 (C17orf48), 20 µg
View other "ADPRM" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213957 representing NM_020233
Red=Cloning site Green=Tags(s) MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVL QLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPE TMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQF NGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTH DGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064618 |
Locus ID | 56985 |
UniProt ID | Q3LIE5 |
Refseq Size | 1518 |
Cytogenetics | 17p13.1 |
Refseq ORF | 1026 |
Synonyms | C17orf48; MDS006; NBLA03831 |
Summary | Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412569 | ADPRM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412569 | Transient overexpression lysate of chromosome 17 open reading frame 48 (C17orf48) |
CNY 3080.00 |
|
PH313957 | C17orf48 MS Standard C13 and N15-labeled recombinant protein (NP_064618) |
CNY 19520.00 |