SKP2 (NM_005983) Human Recombinant Protein
CAT#: TP314001
Recombinant protein of human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 20 µg
View other "SKP2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214001 representing NM_005983
Red=Cloning site Green=Tags(s) MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRL KSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTL DLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQN LSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIP ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK PSCL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 27572672) |
| Reference Data | |
| RefSeq | NP_005974 |
| Locus ID | 6502 |
| UniProt ID | Q13309 |
| Refseq Size | 1600 |
| Cytogenetics | 5p13.2 |
| Refseq ORF | 1272 |
| Synonyms | FBL1; FBXL1; FLB1; p45 |
| Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Acute myeloid leukemia, Apoptosis, Cell cycle, Oocyte meiosis, p53 signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Small cell lung cancer, Ubiquitin mediated proteolysis |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Inhibiting the role of Skp2 suppresses cell proliferation and tumorigenesis of human gastric cancer cells via the upregulation of p27kip1
,Wen, Y;Wang, K;Yang, K;,
Mol Med Rep
,PubMed ID 27572672
[SKP2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401815 | SKP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401815 | Transient overexpression lysate of S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1 |
CNY 4840.00 |
|
| PH314001 | SKP2 MS Standard C13 and N15-labeled recombinant protein (NP_005974) |
CNY 19520.00 |
|
| TP760651 | Purified recombinant protein of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |


