ACSM2B (NM_182617) Human Recombinant Protein
CAT#: TP314283
Recombinant protein of human acyl-CoA synthetase medium-chain family member 2B (ACSM2B), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "ACSM2B" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214283 representing NM_182617
Red=Cloning site Green=Tags(s) MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKAGKRLPSPALW WVNGKGKELMWNFRELSENSQQAANVLSGACGLQRGDRVAVMLPRVPEWWLVILGCIRAGLIFMPGTIQM KSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLNEASTTHHCVET GSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILGSLLESWTLG ACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWR AQTGLDIREFYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRVKPIRPI GIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMKHPAVVE TAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQR TKLRDKEWKMSGKARAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 64.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872423 |
Locus ID | 348158 |
UniProt ID | Q68CK6 |
Refseq Size | 1995 |
Cytogenetics | 16p12.3 |
Refseq ORF | 1731 |
Synonyms | ACSM2; HXMA; HYST1046 |
Summary | Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405460 | ACSM2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426214 | ACSM2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405460 | Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 2B (ACSM2B), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 4840.00 |
|
LY426214 | Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 2B (ACSM2B), transcript variant 2 |
CNY 3080.00 |
|
PH314283 | ACSM2B MS Standard C13 and N15-labeled recombinant protein (NP_872423) |
CNY 19520.00 |
|
PH325976 | ACSM2B MS Standard C13 and N15-labeled recombinant protein (NP_001098539) |
CNY 19520.00 |
|
TP325976 | Recombinant protein of human acyl-CoA synthetase medium-chain family member 2B (ACSM2B), transcript variant 2, 20 µg |
CNY 2900.00 |